SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037297 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037297
Domain Number 1 Region: 32-128
Classification Level Classification E-value
Superfamily Kringle-like 6.52e-28
Family Kringle modules 0.00084
Further Details:      
 
Domain Number 2 Region: 216-323
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-25
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037297   Gene: ENSCJAG00000020057   Transcript: ENSCJAT00000039397
Sequence length 475
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:191986742:192053693:1 gene:ENSCJAG00000020057 transcript:ENSCJAT00000039397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPAARLALLSAAALTLAARPAPNPGLGPGPECFTANGADYRGTQNWTALQGGKPCLFW
NETFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPG
NLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKY
GEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPDFPDTYATGR
VCYWTIRVPGASRIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDF
VILYFFSDRINQAQGFAVLYEAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLY
VITTSPSHPSQTVPGSNSWAPPIGAGSHRVEGWTVYGLATLLILTVTAIVAKILLHITFK
SHRVPASGDLRDCHQPGTSGEIWSIFYKPSTSISIFKKKLKGQSQQDDRNPLVSD
Download sequence
Identical sequences F6UAY1
XP_002743688.1.60252 ENSCJAP00000037297 ENSCJAP00000037297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]