SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037518 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037518
Domain Number 1 Region: 375-548,577-638
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.08e-44
Family Voltage-gated potassium channels 0.0019
Further Details:      
 
Domain Number 2 Region: 642-827
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.03e-44
Family cAMP-binding domain 0.00047
Further Details:      
 
Domain Number 3 Region: 38-127
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.64e-21
Family Flavin-binding PAS domain 0.00000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037518   Gene: ENSCJAG00000020150   Transcript: ENSCJAT00000039630
Sequence length 1126
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:95844347:95879954:1 gene:ENSCJAG00000020150 transcript:ENSCJAT00000039630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVM
QRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDG
AVIMFILNFEVVMEKDMVGSPAHDTNHRGPPTSWLAPGRAKTFRLKLPALLALTARESSV
RVVVDVDLAPAAPSSESLALDEMTAMDNHVAGLGPAEERRVLVGRGYSLNPDASGSSCSL
ARTRSRESCASVRRASSADDIEAMRAGALPPPPRHASTGAMHPLRSGLLNSTSDSDLVRY
RTISKIPQITLNFVDLKGDPFLASPTSDREIIAPKIKERTHNVTEKVTQVLSLGADVLPE
YKLQAPRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLKETEEGPAAPDCGY
ACQPLAVVDLIVDIMFIVDILINFRTTYVNANEEVVSHPGRIAVHYFKGWFLIDMVAAIP
FDLLIFGSGSEELIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACI
WYAIGNMEQPHVDSRIGWLHNLGDQIGKPYNSSGLGGPSIKDKYVTALYFTFSSLTSVGF
GNVSPNTNSEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVREFIRFH
QIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLNRSLLQHCKPFRGAT
KGCLRALAMKFKTTHAPPGDTLVHAGDLLTALYFISRGSIEILRGDVVVAILGKNDIFGE
PLNLYARPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYPEFSDHFWSSLEITFNLRDTNM
IPGSPGSAELEGGFSRQRKRKLSFAHSLFPTDTEQPGEVSALGPGRAGAGPSWGDSPSSG
PSSPESSEDEGPGRSSSPLRLVPFSSPRPPGELPGGEPLTEDCEKSSDTCNPLSGAFSGV
SNIFSFWGDSRGRQYQELPRCPAPTPPSLLNIPLSSPGRRPRSDVESRLDALQRQLNRLE
TRLSADMASVLQLLQRQMTLVPPAYSAVTTPGPGPTSTFPMLPVSPLPPLTLDSLSQVSQ
FMACEELPPGDPELPQDGPTRRLSLPGQLGALTSQPLHRHGSDPGS
Download sequence
Identical sequences F6YFQ4
ENSCJAP00000037518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]