SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037523 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037523
Domain Number 1 Region: 1065-1203
Classification Level Classification E-value
Superfamily PRC-barrel domain 7.69e-63
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000162
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000037523
Domain Number - Region: 3-55
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0934
Family Calponin-homology domain, CH-domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037523   Gene: ENSCJAG00000005196   Transcript: ENSCJAT00000039636
Sequence length 1209
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:19:22340271:22452009:1 gene:ENSCJAG00000005196 transcript:ENSCJAT00000039636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLADSLYNLQLIQEFCQEYLNQCCHFTLEDMLYAASSIKSNYLVFMAELFWWFEVVKPS
FVQPRVVRPQGAEPVKDTPSIPVLNAAKRNVLDSSSDFPSSGEGATFTQFHHHLPSRYSR
PQAHSSASGGIRRSSSMSYVDGFIGTWPKEKRSSVHGVSFDISFDKEDSVQRSTPNQGIT
RSISNEGLTVNNNRVSKHIRKNLSFKPINGEEEAESIEEELNIDSHSDLKSYVPRNTNEL
NSNENIHYKLPNGALQNRILLDEFGNQIETPSIEEALQIIHDTEKSPHTPQPDQIANGFF
LHSQEMSILNSNIKLNQSSPDNVTDTKGALSPITDNTEVDTGIHVPSEDIPETMDEDSSL
RDYTVSLDSDMDDASKFLQDYDIRTGNTREALSPCPSTVSTKSQPGSSASSSSGVKMTSF
AEQKFRKLNHTDGKSSGSSSQKTTPEGSELNIPHVVAWAQIPEETGLPQGRDTTQLLASE
MVHLRMKLEEKRRAIEAQKKKMEAAFTKQRQKMGRTAFLTVVKKKGDGISPLREEAAGAE
DEKVYTDRAKEKESQKTDGQRSKSLADIKESMENPQAKWLKSPTTPVDPEKQWNLASPSE
ETLNEGEILEYTKSIEKLNSSLHFLQQEMQRLSLQQEMLMQMREQQSWVISPPQPSPQKQ
IRDFKPSKQAGLSSAIAPFSSDSPRPTHPSPQSSNRKSTSFSVKNQRTPRPNELKITPLN
RTLTPPRSVDSLPRLRRFSPSQVPIQTRSFVCFGDDGEPQLKESKPKEEVKKEELESNGT
LEQRGHNLEEKEIKPFESTVSEVLSLPVTETVCLTPNEDQLSQPTEPPPKPVFPPTAPKN
VNLIEVSLSDLKPPEKADVPVEKYDGESDKEQFDDDQKVCCGFFFKDDQKAENDMAMKRA
ALLEKRLRREKETQLRKQQLEAEMEHKKEETRRKTEEERQKKEDERARREFIRQEYMRRK
QLKLMEDMDTVIKPRPQVVKQKKQRPKSIHRDHIESPKTPIKGPPVSSLSLASLNTGDNE
SVHSGKRTPRSESVEGFLSPSRCGSRNGEKDWENASTTSSVASGTEYTGPKLYKEPSAKS
NKHIIQNALAHCCLAGKVNEGQKKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETE
EISKLTGIGPKSITKKMIERLYKYNSDRKQFSHIPAKTLSASVDAITIHSHLWQTKRPVT
PKKLLPSKA
Download sequence
Identical sequences F6YEV0
ENSCJAP00000037523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]