SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037909 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037909
Domain Number 1 Region: 16-121
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 6.15e-33
Family Nucleoplasmin-like core domain 0.0000608
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037909   Gene: ENSCJAG00000020389   Transcript: ENSCJAT00000040042
Sequence length 214
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:13:16213454:16224171:-1 gene:ENSCJAG00000020389 transcript:ENSCJAT00000040042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLSSTSSTEEKAVTTVLWGCELSQERRTWTFRPQPKGKQDCKLLLHTICLGEKAKEEMH
RVEILPPGNREDKKTQPVTIASLQASVLPMVTMVGVQLSPPITFQLRAGSGPVFLSGHER
YGKSELRLGQHDSQHVGSHSMPGRPQEDQKGDISLEEESPVKQGKRLVPQKPTSVAKKKK
LEKEQEEVRPRVRDKSPEKKAKAIPRSKKPGFKK
Download sequence
Identical sequences F6WG40
ENSCJAP00000037909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]