SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037916 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037916
Domain Number 1 Region: 14-76
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000236
Family RING finger domain, C3HC4 0.0074
Further Details:      
 
Domain Number 2 Region: 95-157
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000204
Family B-box zinc-binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037916   Gene: ENSCJAG00000020397   Transcript: ENSCJAT00000040049
Sequence length 173
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:160157471:160172446:1 gene:ENSCJAG00000020397 transcript:ENSCJAT00000040049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVR
CPFCSKITRITSLTQLTDNLTVLKIIDTAGLSEAVGLLMCRSCGRRLPRQFCRSCGLVLC
EPCREADHQPPGHCTLPVKEAAEERRRDFGEKLTRLRELMGELQRRKVALEGV
Download sequence
Identical sequences F6VX13
ENSCJAP00000037916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]