SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037938 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037938
Domain Number 1 Region: 8-260
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.13e-67
Family WD40-repeat 0.0000218
Further Details:      
 
Domain Number 2 Region: 245-344
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.59e-21
Family Quinoprotein alcohol dehydrogenase-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037938   Gene: ENSCJAG00000020408   Transcript: ENSCJAT00000040074
Sequence length 373
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:95393999:95422827:1 gene:ENSCJAG00000020408 transcript:ENSCJAT00000040074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGGRSALRVCADHRGGINWLSLSPDGQRLLTGSEDGTARLWSTADGQCCALLQGHESYV
TFCQLEDEAAFTCSADCTIRRWDVLTGQCLQVYRGHTSIVNRILVANNQLFSSSYDRTAR
VWSVDEGQMCQEFRGHRNCVLTLAYSAPWDLPGASCVEEAVAGGLLVTGSTDGTAKVWQV
ASGCCHQTLRGHTGAVLCLVLDAPGHTAFTGSTDATIRAWDILSGEQLRVFREHQGSVIC
LELVNRLVYSGSADKTVKCWLADTGERVRTFTAHRRSVSALKYHAGTLFTGSGDACARAF
DAQSGELRRVFRGHAFIINCLQVHGQVLYTASHDGALRLWDVRGLRGTPPPTRSLSRLFS
NKVGCAAAPLQPA
Download sequence
Identical sequences F6VBN7
ENSCJAP00000037938 XP_002751893.1.60252 ENSCJAP00000037938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]