SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037954 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037954
Domain Number 1 Region: 38-193
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 1.16e-84
Family Hedgehog (development protein), N-terminal signaling domain 0.0000000462
Further Details:      
 
Domain Number 2 Region: 198-358
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.71e-33
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037954   Gene: ENSCJAG00000020423   Transcript: ENSCJAT00000040093
Sequence length 462
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:90875878:90886405:1 gene:ENSCJAG00000020423 transcript:ENSCJAT00000040093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPARCLLLVVVSSLLVCSGLACGPGRGFGKRRHPKKLTPLSYKQFIPNVAEKTLGASG
RYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGV
KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH
IHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSDFLT
FLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSAAGESESSSGVGPPPGDALG
RRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLLEEATGAYAPLTVQGTSFIHRGV
AFMVWVIEEHSWAHRAFRALRLAHALLAALAPARTDRGGDRGGVGGGGGGGRVPPPAPGA
ADDPGAGATAGIHWYSQLLYQIGTWLLDSEALHPLGMAAKSS
Download sequence
Identical sequences F6UP64
ENSCJAP00000037954 ENSCJAP00000037954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]