SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037972 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037972
Domain Number 1 Region: 30-516
Classification Level Classification E-value
Superfamily ALDH-like 9.95e-144
Family ALDH-like 0.000000395
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037972   Gene: ENSCJAG00000020412   Transcript: ENSCJAT00000040112
Sequence length 533
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:99328050:99354522:-1 gene:ENSCJAG00000020412 transcript:ENSCJAT00000040112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVVAAAAVRARILQVSSKVKSPWYSASPFSSSVPTVKLFIDGKFVESKSDKWIDIHNP
ATNEVIGRVPQATKAEMDAAIVSCKRAFPAWADTSILSRQQVLLRYQQLIKENLKEIAKL
ITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMMGETMPSITKDMDLYSYRLPLGVCAGI
APFNFPAMIPLWMFPMAMVCGNTFLMKPSERVPGATILLAKLLQDSGAPDGTLNIIHGQH
EAVNFICDHPDIKAISFVGSNQAGEYIFERGSRHGKRVQANMGAKNHGVVMPDANKENTL
NQLVGAAFGAAGQRCMALSTAILVGEARKWLPELVERAKNLRVNAGDQPGADLGPLITPQ
AKERVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTIISNVKPNMTCYKEEIFGPV
LVVLETETLDEAIQIVNNNPYGNGTAIFTTNGATARKYAHLVDVGQVGVNVPIPVPLPMF
SFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQWKEEDATLSSPAVVMPTMGR
Download sequence
Identical sequences F7CA96
XP_009004577.1.60252 ENSCJAP00000037972 ENSCJAP00000037972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]