SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038147 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038147
Domain Number 1 Region: 32-135
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.45e-17
Family Phosphate binding protein-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038147   Gene: ENSCJAG00000020533   Transcript: ENSCJAT00000040303
Sequence length 333
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:38331937:38481786:1 gene:ENSCJAG00000020533 transcript:ENSCJAT00000040303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYGTVRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGVDNCVSSPSEGIRKAKKGN
YAFLWDVAVVEYAALTDDDCSVTVIGNSISSKGYGIALQHGSPYRDLFSQRILELQDTGD
LDVLKQKWWPHMGRCDLTSHASAQADGKSLKLHSFAGVFCILAIGLLLACLVAALELWWN
SNRCHQETPKEDKEVNLEQVHRRMNSLMDEDIAHKQISPASIELSALEMGGLAPTQTLEP
TREYQNTQLSVSTFLPEQSSHGTSRTLSSGPSSNLPLPLSSSATMPSMQCKHRSPNGGLF
RQSPVKTPIPMSFQPMPGGVLPEALDTSHGTSI
Download sequence
Identical sequences F7I4W2
ENSCJAP00000038147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]