SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038258 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000038258
Domain Number - Region: 235-364
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00698
Family Voltage-gated potassium channels 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038258   Gene: ENSCJAG00000007063   Transcript: ENSCJAT00000040422
Sequence length 439
Comment pep:novel chromosome:C_jacchus3.2.1:5:62341992:62440731:-1 gene:ENSCJAG00000007063 transcript:ENSCJAT00000040422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQVLAYILQREMQEPECRHLSRKFTEWAYGPVHSSLYDLSCIDTCEKNSVLEVIAYSSSE
TPNRHDMLLVEPLNRLLQDKWDRFVKRIFYFNFFIYCLYMIIFTMAAYYRPVVGLVRPHP
LALTHKMGWLQLLGRMFVLIWATCISVKEGIEIFLLRPSDLQSILSDAWFHFVFFIQALL
VILSDFLYLFAYIECLACLVLAMALGWVNMLYYTWGFQSMGMYSIMIQKVILHDVLKFLF
VYIVFLLGFGVALASLIEKCPKDNKDCSSYGSFSDAVLELFKLTIGLGDLNIQQNSKYPI
LFLFLLITYVILTFVLLLNMLIALMGETVENVSKESECIWHLQRARTILEFEKMLPEWLR
RRFRMGEMCKVAEEDFRLCLRINEVKWTEWKTHVSFLNEDPGPGRRTADFNKIQESSRNN
SKTTLNAFEEIEEFPETSV
Download sequence
Identical sequences F7INM6
ENSCJAP00000038258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]