SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038473 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038473
Domain Number 1 Region: 74-260
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.23e-70
Family T-box 0.00000151
Further Details:      
 
Domain Number 2 Region: 2217-2297
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000314
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038473   Gene: ENSCJAG00000020688   Transcript: ENSCJAT00000040649
Sequence length 2858
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:34122184:34235704:-1 gene:ENSCJAG00000020688 transcript:ENSCJAT00000040649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKQQIILANQDGGTVAGAAPTFFVILKQPGNGKTDQGILVTNQDACALTSSVSSPVKS
KGKICLPADCTVGGITVTLDNNSMWNEFYHRSTEMILTKQGRRMFPYCRYWITGLDSNLK
YILVMDISPVDNHRYKWNGRWWEPSGKAEPHVLGRVFIHPESPSTGHYWMHQPVSFYKLK
LTNNTLDQEGHIILHSMHRYLPRLHLVPAEKAVEVIQLNGPGVHTFTFPQTEFFAVTAYQ
NIQITQLKIDYNPFAKGFRDDGLNSKPQRDGKQKNSSDQEGNNISSSSGHRVRLTEGQGS
EIQPGDSDPLSRGHETSGKGLEKTSLNIKRDFLGFMDTDSALSEVPQLKQEISECLIANN
FEDDSHITSPLDQNGSFNVVIKEEPLDDYDYEFGECPERVTVKQEETDEETDVYSNSDDD
PILEKQLKRHNKVDNPEADHLSSKWLPSSPSGVAKAKMFKLDAGKMPVVYLEPCAVTKST
VKISELPDNMLSTSRKDKSSMLTEFEYLPTYIENSNETAFCLGKESENGLRKHSPDLRVV
QKYPLLKEPLWKYPNISDSISTERIFDSSKGSAGDSLSGKEELGRKRTTMLKIATAPKVV
NANQNASPNIPGKRGRPRKLKLCKAGRPPKNTGKSLISTKNTPVGPGSTFPDVKPDLEDV
DGVLFVSFESKEALDIHAVDGTTEESSGLQASTTNDSGCRARISQLEKELIEDLKSLRHK
QVIHPGLQEVGLKLNSVDPTMSIDLKYLGVQLPLAPATSFPFWNLTGTNPASPDAGFPFV
SRTGKTNDFTKIKGWRGKFHSASASRNEGGNSESSLKNRSAFCSDKLDEYLENEGKLMET
SMGFSSNAPTSPVVYQLPTKSTSYVRTLDSVLKKQSTISPSTSYSLKPHSVAPASRKAKS
QNRQATFSGRTKSSYKSILPYPVSPKQKYSHMILGDKVTKNSSGTISENQANNFVVPTLD
ENTFPKQISLRQAQQQQQQQQQQGSRPPGLSKSQVKLMDLEDCALWEGKPRTYITEERAD
VSLTTLLTAQASLKTKPIHTIIRKRAPPCNNDFCRLGCVCSSLALEKRQPAHCRRPDCMF
GCTCLKRKVVLVKGGSKTKHFQRKAAHRDPIVYDTLGEEAREEEEGVKEEEEQLKEKKKR
KKLEYTICETEPEQPVRHYPLWVKVEGEVDPEPVYIPTPSVIEPMKPLLLPQPEVLSTTV
KGRLVPGIKSARSYTPKPNPVIREEDKDPVYLYFESMMTCARVRVYERKKEDQRQLSSSS
SPSPSFQQQNSCHSSPENHNNAKEPDSEQQPLKQLTCDLEDDSGKLQEKSWKSSCNEGES
SSTSYMHQRSPGGPTKLIEIISDCNWEEDRNKILSILSQHINSNMPQSLKVGSFIIELAS
QRKSRGEKNPPVYSSRVKISMPSCQDQDDMAEKSGSETPDGPLSPGKMEDISPVQTDALD
SVRERLHGGKGLPFYAGLSPAGKLVAYKRKPSSSTSGLIQVASNAKVAASRKPRTLLPST
SNSKMASSSGAPTNRPGKNLKAFVPAKRPIENAAQIPVATPQVSSNTVKRAGPRLLLIPV
QQGSPSLRPVSNTQLQGHRMVLQPVRSPSGMNLFRHPNGQIVQLLPLHQLRGSNTQPNLQ
PVMFRNPGSVMGIRLPAPSKPSETPPSSTSSSAFSVMNPVIQAVGSSAVNVITQAPSLLS
SGASFVSQAGTLTLRISAPEPQSFASKTGSETKITYSSGGQPVGTASLIPLQSGSFALLQ
LPGQKPVPSSILQHVASLQMKRESQNPDQKDGKNSIKREEETKKVLQSEGQAVDPEANTV
KQNSGAATSEETLNDSLEDRSDHLDEESLREEGSATVKPSKHSCITGSHRDEDYKDVNEE
CGARNHKSSKEKVAVLEVRTISEKASNKTVQNMSKVQHQKLGDRKVEQQKGLDNPEENSN
EFPDISKEESKFELSGSKGVEQQSHPQTEATEKECGDSLEKDSIRERWRRHLKGPLTRKC
VGASQECKQEADEQLIKETKTCQENSDVFQQQQSISDLLGKRGITEDASVLKTECDSWSR
ISSPSAFSIVPRRAAKSSRGNGHFQGHLLLPGEQIQPKQKKKSGRSSADLTVFDLEEDED
ENEKTDDSIDETVDVVSDYQSEEVDDIEKNNCVEYIEDDEEHVDIETVEELSDEINVAHL
KTTAVHTESFKQPCRTHISADEKAAERSRKAPPIPLKLKPDYWSDKLQKEAEAFAYYRRT
HTANERRRRGEMRDLFEKLKITLGLLHSSKVSKSHILTRAFSEIQGLTDQADKLIGQKNL
LTRKRNILIRKVSSLSGKTEEVVLKKLEYIYAKQQALEAQKRKKKMGSDEFDMSPRISKQ
QEGSSASSVDLGQMFINNRKGKPLILSRKKDQATENTSPSNTPHTSANLVMTPQGQLLTL
KGPLFSGPVVTVSPDLLESDLKPQVASSAMAQPENDDLFMMPRIVNVTSLATEGGLIDMG
GSKYPHEVPDGKPSDHLKDTVRNEDNSLEDKGRISSRGNRDGRVTLGPSQIFLANKDSGY
PQIVDVSSMQEAQEFLPKKISGDRRGIQYKWKESELRGERVKSKESSFHKLKIKDLKDSS
IEMELRKVTSAIEEAALDPSELLTNMEDEDDTDETLTSLLNEIAFLNQQLNDDSVSLAEL
PSSVDTEFPGDARQSFISKVPPGNRATFQVEHLGAGLKELPDVQGESDSISPLLLHLEDD
DFSENEKQLAEPASEPDVLKIVIDSEIKDSLLSNKKDTDGGKNTSGLPAEPESVSSPPIL
HMKTGLENSNSTDTLWRPMPKLAPLGLKVANPSSDVDGQNLKVMPCLAPIAAKVGSVGHK
MNLTGNDQEGRESKVMPTLAPVMAKLGNLGASPGSAGK
Download sequence
Identical sequences F7IQR1
ENSCJAP00000038473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]