SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038542 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038542
Domain Number 1 Region: 68-125
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 4.87e-17
Family Transcriptional factor domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000038542
Domain Number - Region: 13-44
Classification Level Classification E-value
Superfamily RING/U-box 0.0328
Family RING finger domain, C3HC4 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038542   Gene: ENSCJAG00000020719   Transcript: ENSCJAT00000040718
Sequence length 126
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:30367402:30370747:1 gene:ENSCJAG00000020719 transcript:ENSCJAT00000040718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ICVMDLASTCSSFQSDLDFCSECGSVLPLPGAQDTVTCTRCGFNINVRDFEGKVVKTSVV
FHQLGTAMPVSVEEGPEFQGPVVDRRCSRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKF
QEKEDS
Download sequence
Identical sequences F7G0Q7
ENSCJAP00000038542 ENSCJAP00000048528 ENSCJAP00000038542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]