SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038686 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038686
Domain Number 1 Region: 33-147
Classification Level Classification E-value
Superfamily FKBP-like 6.68e-35
Family FKBP immunophilin/proline isomerase 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038686   Gene: ENSCJAG00000020795   Transcript: ENSCJAT00000040867
Sequence length 201
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:37689037:37693531:-1 gene:ENSCJAG00000020795 transcript:ENSCJAT00000040867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRPSLLPLHMLLLLLHSAAVCGTETGFETESPVRTLQVETLVEPPEPCAEPAAFGDTL
HIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYG
KRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKA
NRPKVSKKKLKEEKRNKSKKK
Download sequence
Identical sequences F7ISZ6
ENSCJAP00000038686 XP_002752466.1.60252 ENSCJAP00000038686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]