SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038804 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038804
Domain Number 1 Region: 35-189
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 1.75e-79
Family Hedgehog (development protein), N-terminal signaling domain 0.000000259
Further Details:      
 
Domain Number 2 Region: 194-340
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 8.73e-37
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038804   Gene: ENSCJAG00000020862   Transcript: ENSCJAT00000040990
Sequence length 391
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:37865845:37870928:-1 gene:ENSCJAG00000020862 transcript:ENSCJAT00000040990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSMALLANLLPLCCLALLALPAQSVGRRRYVRKQLVPLLYKQFVPGVPERTLGASGPAEG
RVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRV
TEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVS
VKADNSLAVRAGGCFPGNATVRLRSGERKGLRELHRGDWVLAADASGRVVPTPVLLFLDR
DLQRRASFVAVETERPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSVLAPGG
DALRPARVARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRAFAPLRLLHA
LGALLPGGAVQPTGMHWYSRLLYRLAEELLG
Download sequence
Identical sequences F7I6S1
ENSCJAP00000038804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]