SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038821 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038821
Domain Number 1 Region: 52-108
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.06e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038821   Gene: ENSCJAG00000020866   Transcript: ENSCJAT00000041008
Sequence length 179
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:6542042:6549036:-1 gene:ENSCJAG00000020866 transcript:ENSCJAT00000041008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGLAGPVVVVRQRQAANAR
ERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYIAHLANVLLLGDAADDGQPC
FRAAGGAKSAVPAAADGGRQPRSICTFCLSNQRKGGGRRDLGGSCLKVRGVAPLRGPRR
Download sequence
Identical sequences F7I4D3
ENSCJAP00000038821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]