SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038980 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038980
Domain Number 1 Region: 10-132
Classification Level Classification E-value
Superfamily POZ domain 3.35e-29
Family BTB/POZ domain 0.00021
Further Details:      
 
Domain Number 2 Region: 610-672
Classification Level Classification E-value
Superfamily A DNA-binding domain in eukaryotic transcription factors 5.23e-22
Family A DNA-binding domain in eukaryotic transcription factors 0.0014
Further Details:      
 
Domain Number 3 Region: 658-705
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00000337
Family Leucine zipper domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038980   Gene: ENSCJAG00000001013   Transcript: ENSCJAT00000041176
Sequence length 844
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:89013047:89418920:-1 gene:ENSCJAG00000001013 transcript:ENSCJAT00000041176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVDEKPDSPMYVYESTVHCTNILLGLNDQRKKDILCDVTLIVERKEFRAHRAVLAACSE
YFWQALVGQTKNDLVVSLPEEVTARGFGPLLQFAYTAKLLLSRENIREVIRCAEFLRMHN
LEDSCFSFLQTQLLNSEDGLFVCRKDAACQRPHEDLADRENSAGEEEEEEEETMDSETPK
MACPRDQMLPEPISFEAAPIPIAEKEETLLPEPDVPTDTKESSEKDALTQYPRYKKYQLA
CTKNVYNASSHSTSGFASTNGEDNSNNSLKPGLSMGQIKSEPPSEENEEESITLCLSGDE
PDAKDRVGDVEMDRKQPSPAPTPTAPIAAACLERSRSVASPSCLRSLFSITKSVELSGLP
STSQQHFARSPACPFDKGITQGDLKTDYTPFTGNYGQPHVGQKEVSNFTVGSPLRGPGLE
ALCKQEGELDRRSVIFSSSACDQVSTSVHSYSGVSSLDKDLSEPVPKGLWVGAGQSLPSS
QAYSHGGLMADHLPGRMRPNTSCPVPIKVCPRSPPLETRTRTSSSCSSYSYAEDGSGGSP
CSLPLCEFSSSPCSQGARFLATEHQEPSLMGDGMYNQVRPQIKCEQSYGTNSSDESGSFS
EADSESCPVQDRGQEVKLPFPVDQITDLPRNDFQMMIKMHKLTSEQLEFIHDVRRRSKNR
IAAQRCRKRKLDCIQNLECEIRKLVCEKEKLLSERNQLKACMGELLDNFSCLSQEVCRDI
QSPEQIQALHRYCPVLRPMDLPTASSINPAPLGVEQNLAASQCAVGENVPCCLEPGAAPP
GPPWAPSNTSENCTSGRRLEGTDPGTFSERGPPLEPRSQTVTVDFCQEMTDKCTTDEQPR
KDYT
Download sequence
Identical sequences F7IIH7
XP_002746873.1.60252 XP_017826752.1.60252 ENSCJAP00000001733 ENSCJAP00000038980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]