SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038992 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038992
Domain Number 1 Region: 142-459
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.36e-124
Family Transglutaminase core 0.0000000000251
Further Details:      
 
Domain Number 2 Region: 3-139
Classification Level Classification E-value
Superfamily E set domains 1.01e-41
Family Transglutaminase N-terminal domain 0.000000399
Further Details:      
 
Domain Number 3 Region: 482-594
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.16e-32
Family Transglutaminase, two C-terminal domains 0.00000154
Further Details:      
 
Domain Number 4 Region: 594-692
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.7e-26
Family Transglutaminase, two C-terminal domains 0.00000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038992   Gene: ENSCJAG00000020950   Transcript: ENSCJAT00000041188
Sequence length 693
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:8122458:8170493:1 gene:ENSCJAG00000020950 transcript:ENSCJAT00000041188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALELQSINWQTAFNRQAHHTDKFSSQELILRRGQNFEVLMVMNKGLGSRERLEFIVST
GPYPSESAMTKAVFPLSNGSSGGWSAVLQASNGNTVTINISSPASAPIGRYTMALQISSQ
GGVSSVNLGKFILLFNPWLNVDSVFMGNHAEREEYVQEDAGIIYVGSTNRISMIGWNFGQ
FEEDILSICLSILDRSLNYRRDAATDVAHRNDPKYVGRVLSAMINSNDDNGVLTGNWSGN
YTGGRDPRNWNGSVEILKDWKKSGFRPVRFGQCWVFAGTLNTALRSLGIPSRVITNFNSA
HDTDRNLSVDVYYDPMGNPLDKGSDSMWNFHVWNESWFVRSDLGPSYSGWQVLDATPQER
SQGVFQCGPASVIGIREGDVNLSFDMPFIFAEVNADRITWLFDSNTGTQRKNSVDSRSIG
RYISTKAVGSNARMDITDKYKYPEGSEEERGVFQKALGKLKPNASFGATSSTGSETEEQE
PSISGKFKVTGSLEVGKEVNLVLQLKNLSSDRKRVTVNMTAWTIVYNGTLVHEVWKDSAT
MSLDPEEEAEYPVKISYAQYEKYLKSDNMIRITAVCKVPDEPEVVVERDVILDNPTLTLE
VLSEARVRKPVNVQMLFSNPLDEPVRDCVLMVEGSGLLLGNLKIDVPTLRPKERSRVRFE
ILPTRSGTKQLLADFSCNKFHAIKAMLSIDVAE
Download sequence
Identical sequences F7IIF1
XP_017827391.1.60252 ENSCJAP00000038991 ENSCJAP00000038992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]