SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039178 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039178
Domain Number 1 Region: 883-1040,1092-1159
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.49e-25
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 2 Region: 384-601
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.26e-18
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 36-203,259-328
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000785
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 4 Region: 1209-1449
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000141
Family Voltage-gated potassium channels 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039178   Gene: ENSCJAG00000021036   Transcript: ENSCJAT00000041387
Sequence length 1736
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:16226140:16601285:-1 gene:ENSCJAG00000021036 transcript:ENSCJAT00000041387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKRKQSSRVEAQPVADFGPDESLSDNADILWINKPWVHSLLRICAIISVISVCMNTPVT
FEHYPPLQYVTFTLDTLLMFLYTAEMIAKMHIRGIVKGDSSYVKDRWCVFDGFMVFCLWV
SLVLQVFEIADIVDQMSPWGMLRIPRPLIMIRAFRIYFRFELPRTRITNILKRSGEQIWS
VSIFLLFFLLLYGILGVQMFGTFTYHCVVNDTKPGNVTWNSLAIPDTHCSPELEEGYQCP
PGFKCMDLEDLGLSRQELGYSGFNEIGTSIFTVYEAASQEGWVFLMYRAIDSFPRWRSYF
YFITLIFFLAWLVKNVFIAVIIETFAEIRVQFQQMWGSRSSTTSTATTQLLHDELLQAWQ
LAGLEVMNIQILSVLPPQKMMRSSVFHMFILSMVTVDVIVAASNYYKGENFRRQYDEFYL
AEVAFTVLFDLEALLKIWCLGFTGYISSSLHKFELLLVIGTTLHVYPDLYHSQFTYFQVL
RVVRLIKISPALEDFVYKIFGPGKKGSLVVFTSLLIVMSAISLQMFCFVEELDRFTTFPR
AFMSMFQILTQEGWVDVMDQTLNAVGHMWAPVVAIYFILYHLFATLILLSLFVAVILDNL
ELDEDLKKLKQLKQSEANADTKEKLPLRLRIFEKFPNRPQMVKISKLPSDFTVPKIRESF
MKQFIDRQQQDTCCLLRSLPSTSSSSCDHSKRSAVEDNKYIDQKLRKSVFSIRARNLLEK
ETAVTKILRACTRQRMLSGSFEGQPAKERSILSVQHHIRQERRSLRHGSNSQRISRGKSL
ETLTQDHSNTVRYRNAQREDSEIKMIQEKKEQAEMKRKVQEEELRENHPYFDKPLFIVGR
EHRFRNFCRVVVRARFNASKTDPVTGAVKNTKYHQLYDLLGLVTYLDWVMIIVTICSCIS
MMFESPFRRVMHAPTLQIAEYVFVIFMSIELNLKIMADGLFFTPTAVIRDFGGVMDIFIY
LVSLIFLCWMPQNVPAESGAQLLMVLRCLRPLRIFKLVPQMRKVVRELFSGFKEIFLVSI
LLLTLMLVFASFGVQLFAGKLAKCNDPNIIRREDCNGIFRINVSVSKNLNLKLRPGEKKP
GFWVPRVWANPRNFNFDNVGNAMLALFEVLSLKGWVEVRDVIIHRVGPIHGIYIHVFVFL
GCMIGLTLFVGVVIANFNENKGTALLTVDQRRWEDLKSRLKIAQPLHLPPRPDNDGFRAK
MYDITQHPFFKRTIALLVLAQSVLLSVKWDVEDPVTVPLATMSVVFTFIFVLEVTMKIIA
MSPAGFWQSRRNRYDLLVTSLGVVWVVLHFALLNAYTYMMGACVIVFRFFSICGKHVTLK
MLLLTVVVSMYKSFFIIVGMFLLLLCYAFAGVVLFGTVKYGENINRHANFSSAGKAITVL
FRIVTGEDWNKIMHDCMVQPPFCTPDEFTYWATDCGNYAGALMYFCSFYVIIAYIMLNLL
VAIIVENFSLFYSTEEDQLLSYNDLRHFQIIWNMVDDKREGVIPTFRVKFLLRLLRGRLE
VDLDKDKLLFKHMCYEMERLHNGGDVTFHDVLSMLSYRSVDIRKSLQLEELLAREQLEYT
IEEEVAKQTIRMWLKKCLKRIRAKQQQSCSIIHSLRESQQQELSRFLNPPSIETTQPSED
TNANSQDNSMQPETSSQQQLLSPTLSDRGGSRQDAADAGKPQRKFGQWRLPSAPKPISHS
VSSVNLRFGGRTTMKSVVCKMNPMTDVASCGSEVKKWWTRQLTVESDESGDDLLDI
Download sequence
Identical sequences F7H010
ENSCJAP00000039178 ENSCJAP00000039178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]