SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039294 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039294
Domain Number 1 Region: 6-190
Classification Level Classification E-value
Superfamily ITPase-like 7.85e-63
Family ITPase (Ham1) 0.00000000834
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039294   Gene: ENSCJAG00000021114   Transcript: ENSCJAT00000041513
Sequence length 194
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:9006089:9020840:1 gene:ENSCJAG00000021114 transcript:ENSCJAT00000041513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASLVGKKIVFVTGNAKKLEEVIQILGDKFPCTLVAQKIDLPEYQGEPDEISIQKCQEA
ARQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQLLAGFEDKSAYALCTFAL
STGDPNQPVRLFRGRTLGQIVAPRGCRDFGWDPCFQPDGYEQTYAEMPKAEKNAISHRFR
ALLELQEYFGSVTS
Download sequence
Identical sequences F7F179
ENSCJAP00000039294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]