SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039456 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039456
Domain Number 1 Region: 60-509
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 1.7e-116
Family 2-methylcitrate dehydratase PrpD 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039456   Gene: ENSCJAG00000021189   Transcript: ENSCJAT00000041681
Sequence length 536
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:37682719:37703980:-1 gene:ENSCJAG00000021189 transcript:ENSCJAT00000041681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAFSQEGHLASLNSPPLLPDSNWSHPQFSSYSSVYKESAIRPFSVSRCLGRQVINAHLS
VTESFAKTIHGLKVGHLTDRVIQRSKRMILDTLGAGFLGTSTEVFHKASQYSKIYSSNIS
STVWGRPDIRLPPTYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVLTALAEALPRSPKF
SGLDLLLAFNVGIEVQGQLLHFAKEANDIPKRFHPPSVVGTLGSAAAASKFLGLSLTKCQ
EALAIAVSHAGAPMANAATQTKPLHIGNAAKHGIEAAFLAMLGLQGNKQILDLEAGLGAF
YANYSPKVLPNLHSYSWLLDQQDVAFKRFPAHLSTHWVADAAASVRKHLVAEKTLLPIDH
IKRIVLRIPKVQYVNRPSPDSEHEARHSFQYVACAMLLDGGITVPSFHECQINRPQVREL
LNKVELEYPPDNLPSFNTLYCEISVTLKDGAIFTDRSDTFYGHWRKPLSQEDLEEKFRDN
TSRMLSCDTVESLIKIVKNLEDLEDCSVLTTLLKGPSPPEVASNSPACNNSITQSL
Download sequence
Identical sequences F7FT06
ENSCJAP00000039456 ENSCJAP00000039456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]