SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039521 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039521
Domain Number 1 Region: 177-243
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.7e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039521   Gene: ENSCJAG00000021222   Transcript: ENSCJAT00000041750
Sequence length 312
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:82120145:82126750:-1 gene:ENSCJAG00000021222 transcript:ENSCJAT00000041750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTERPPSEAACSDPQLEGRDAAEARMAPPHLVLLNGVAKETSRAAPAEPPVIELGARGGP
GGGPAGGGGAARDLKGRDAAAAEARHRVPTTELCRPPAELPGDGRMVQLSPPALAAPAAP
GRALLYSLSQPLASLGSHSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITDGPHTKVVRRI
FTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEG
TQRAKPGKDPVVGASAPPDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHP
AMLPAADGAGPR
Download sequence
Identical sequences F7DTT3
ENSCJAP00000039521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]