SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039872 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039872
Domain Number 1 Region: 156-227,274-528
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 2.36e-92
Family NadC C-terminal domain-like 0.0000215
Further Details:      
 
Domain Number 2 Region: 46-155
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 1.62e-26
Family NadC N-terminal domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039872   Gene: ENSCJAG00000021422   Transcript: ENSCJAT00000042124
Sequence length 573
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:50959308:51089423:1 gene:ENSCJAG00000021422 transcript:ENSCJAT00000042124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRAQLLEMEARAAQMARQVQELQPYKASTRARGHRRGWAGVRAGGXXEFELFFRRCPFGG
AFALAAGLRDCVRFLRAFRLLDADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEG
SLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRR
AQGPDGGLTASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSGSELPPDPILAP
AAGEGPGVDLAAEAQVWLERVCAHLGLGLQEPHPGERAAFVAYALAFPRAFQGLLDSYSV
RRSGLPNFLAVSLALGELGYRAVGVRLDSGDLLQQAQEIRQVFRTVAAQFQVPWLESVPI
AVSNNIDEEALAQLAQEGSEVNVIGIGTSVVTCPQQPSLGCVYKLVAVAGQPRMKLTEDP
EKQTLPGSKAAFRLLGSDGSLLMDVLQLAEEPVPRAGQELRVWPRGAQEPCTVRPARVEP
LLRLCLQQGQLCEPLPSLAESRALAQLSLSQLSPAHRRLRNPAQYQVGECLPWCPALGAP
TPPTHAPLLCSLQVVLSERLQALVDSLRVGASP
Download sequence
Identical sequences F7FRD5
ENSCJAP00000039872 ENSCJAP00000044543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]