SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039904 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039904
Domain Number 1 Region: 2-57
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.14e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000039904
Domain Number - Region: 80-88
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0837
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039904   Gene: ENSCJAG00000021441   Transcript: ENSCJAT00000042157
Sequence length 123
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:50381921:50383246:-1 gene:ENSCJAG00000021441 transcript:ENSCJAT00000042157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVLLAGEACG
DGQPCHSGPAFFHAARAGSPPPPPPPPPARDGENAQPKQICTFCLSNQRKLSKDRDRKTA
IRS
Download sequence
Identical sequences F7DSF8
ENSCJAP00000039904 ENSCJAP00000039904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]