SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000040249 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000040249
Domain Number 1 Region: 5-129
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.44e-24
Family Phosphate binding protein-like 0.00000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000040249   Gene: ENSCJAG00000021621   Transcript: ENSCJAT00000042513
Sequence length 809
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:7915273:7924487:1 gene:ENSCJAG00000021621 transcript:ENSCJAT00000042513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLSLKTGKLDAF
IYDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAILQLFGDGEM
EELEALWLTGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEHLFYWQFRHC
FMGVCSGTPGMVFSISRGIYSCIHGVAIEERQSVMNSPTATMNNTHSNILRLLRTAKNMA
NLSGVNGSPQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFSDYISEVERT
FGNLQLKDSNVYQDHYHHHHRPHSIGSASSIDGLYDCDNPPFSTQSRSISKKPLDIGLPS
SKHSQLSDLYGKFSFKSDRYSGHDDLIRSDVSDISTHTVTYGNIEGNAAKRRKQQYKDSL
KKRPASAKSRREFDEIELAYRRRPPRSPDHKRYFRDKEGLRDFYLDQFRTKENSPHWEHV
DLTDIYKERSDDFKRDSVSGGGPCTNRSHIKHGTGDKHGVVSGVPAPWEKNLTNVEWEDR
SGGNFCRSCPSKLHNYSTAVTGQNSGRQACIRCEACKKAGNLYDISEDNSLQELDQPAAP
VAVTSNASTTKYPQSPTNSKAQKKNRNKLRRQHSYDTFVDLQKEEAALAPRSVSLKDGRF
MDGPYATMSAGESTFANIKSSVPTAGHHHHNNPGGGYMLSKSLYPDRVTQNPFIPTFGDD
QCLLHGSKSYFFRQPVAGASKARPDFRALVTNKPVVSALHGAVPARFQKDICIGNQSNPC
VPNNKNPRAFNGSSNGHVYEKLSSIESDV
Download sequence
Identical sequences F7ILH1
ENSCJAP00000040249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]