SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000040391 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000040391
Domain Number 1 Region: 40-145
Classification Level Classification E-value
Superfamily GlnB-like 3.52e-38
Family Divalent ion tolerance proteins CutA (CutA1) 0.00000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000040391   Gene: ENSCJAG00000021690   Transcript: ENSCJAT00000042660
Sequence length 156
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:34224486:34225813:-1 gene:ENSCJAG00000021690 transcript:ENSCJAT00000042660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVLLPVASRLLLLPRALLTMASGSPPTQPSPASGSGSGYVPGSVSAAFVTCPNEKVAKE
IARAVVEKHLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPY
EVAEVIALPVEQGNFPYLQWVHQVTELVSDSSTVLP
Download sequence
Identical sequences F7INP9
ENSCJAP00000040391 ENSCJAP00000040393 ENSCJAP00000050461 XP_008992501.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]