SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000040409 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000040409
Domain Number 1 Region: 344-464
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0000000000000752
Family Glyoxalase I (lactoylglutathione lyase) 0.03
Further Details:      
 
Domain Number 2 Region: 211-330
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0000000000088
Family Glyoxalase I (lactoylglutathione lyase) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000040409   Gene: ENSCJAG00000021702   Transcript: ENSCJAT00000042681
Sequence length 501
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:59272475:59291118:-1 gene:ENSCJAG00000021702 transcript:ENSCJAT00000042681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTPFSLSTGSSFRYSTRLKKKTFGTAPALRASAMSLRPSSRIFPCFSRNGLDLTIVIT
LLQPPVPGKSLIVAKPRLFPGAGSVGWGHLKRLFLLWLVGTGFICCRGCFPGAHFRSTTS
PKGNATFTGLRRSARTQRLQGPKPGPPAATVARQTARVYPARPSSQRPELRHESAPSTTG
DVTDRRALYGRGAAVRVTAARGRRHGCSQLHFVFKVGNRFQTARFYRDVLGMKVLRHEEF
EEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGIGDYKLGNDFMGLTLASSQAV
SNARKLGWPLMEVAEGVFETEAPGGYKFYLQNCSLPQSDPVLKVTLAVSDLQKSLNYWCN
LLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGAVDHAAAFGRIAFSCPQKELPGLEDL
MKREKQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGSRLLDD
AMAADKSDEWFAKHNKPKASG
Download sequence
Identical sequences F7IEA6
ENSCJAP00000040409 ENSCJAP00000040411 ENSCJAP00000040409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]