SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000040410 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000040410
Domain Number 1 Region: 157-277
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0000000000000295
Family Glyoxalase I (lactoylglutathione lyase) 0.03
Further Details:      
 
Domain Number 2 Region: 4-146
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.00000000476
Family Glyoxalase I (lactoylglutathione lyase) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000040410   Gene: ENSCJAG00000021702   Transcript: ENSCJAT00000042682
Sequence length 314
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:59272475:59290126:-1 gene:ENSCJAG00000021702 transcript:ENSCJAT00000042682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARRALHFVFKVGNRFQTARFYRDVLGMKVQAGYSISLNKCSSSQQSRGSECTCITEDS
FLKPYDGKWSKTMVGFGPEDDHFVAELTYNYGIGDYKLGNDFMGLTLASSQAVSNARKLG
WPLMEVAEGVFETEAPGGYKFYLQNCSLPQSDPVLKVTLAVSDLQKSLNYWCNLLGMKIY
EKDEEKQRALLGYADNQCKLELQGVKGAVDHAAAFGRIAFSCPQKELPGLEDLMKREKQK
ILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGSRLLDDAMAADKS
DEWFAKHNKPKASG
Download sequence
Identical sequences F7IEA8
ENSCJAP00000040410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]