SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000040782 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000040782
Domain Number 1 Region: 180-372
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.11e-39
Family Voltage-gated potassium channels 0.0046
Further Details:      
 
Domain Number 2 Region: 41-145
Classification Level Classification E-value
Superfamily POZ domain 4.93e-32
Family Tetramerization domain of potassium channels 0.00000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000040782   Gene: ENSCJAG00000022123   Transcript: ENSCJAT00000043108
Sequence length 372
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:126129327:126130445:-1 gene:ENSCJAG00000022123 transcript:ENSCJAT00000043108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLE
RYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELA
FFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDTTGESALPTMTARQRVWRAFENPHT
STMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERYAVAFFCLDTACVMIF
TVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRI
FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAA
FWYTIVTMTTLG
Download sequence
Identical sequences F7IQS8 G5BNR2 L5KR79
ENSCJAP00000040782 XP_010342094.1.74449 XP_010371593.1.97406 XP_017369298.1.71028 XP_017749804.1.44346 ENSCPOP00000010657 10141.ENSCPOP00000010657 ENSCPOP00000010657 HGL_H00000333496 ENSCJAP00000040782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]