SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000040825 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000040825
Domain Number 1 Region: 137-225
Classification Level Classification E-value
Superfamily eEF-1beta-like 5.76e-36
Family eEF-1beta-like 0.00000327
Further Details:      
 
Domain Number 2 Region: 9-63
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000000725
Family Glutathione S-transferase (GST), C-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000040825   Gene: ENSCJAG00000022169   Transcript: ENSCJAT00000043154
Sequence length 225
Comment pep:novel chromosome:C_jacchus3.2.1:11:50864233:50864910:1 gene:ENSCJAG00000022169 transcript:ENSCJAT00000043154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFGDLKSSAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSGPPPADLCHALRWYNHIK
SYEKEKASLPGVKKALGKYGPVDVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLRE
ERLAQYESKKAKKPALVAKSSILLDVKPWDDEIDMAKLEECVRSIQADGLVWGSSKLVPV
GYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI
Download sequence
Identical sequences F7IGD4
ENSCJAP00000040825 ENSCJAP00000040825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]