SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000040860 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000040860
Domain Number 1 Region: 66-103
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.0000000000000419
Family Ribosomal protein L36 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000040860   Gene: ENSCJAG00000022208   Transcript: ENSCJAT00000043193
Sequence length 103
Comment pep:novel chromosome:C_jacchus3.2.1:22:33538303:33538869:-1 gene:ENSCJAG00000022208 transcript:ENSCJAT00000043193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLLIRKMVNPLLYLSRHTLQPPALSTFLLGSLGGAAPVAVEPGAGVRSFLSPSLLPHL
LPALGFKTKGVLKKRCKDCYRVKRRGRWYIYCKTHPRHKQRQM
Download sequence
Identical sequences F7I9B8
ENSCJAP00000040860 XP_008986259.1.60252 ENSCJAP00000040860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]