SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000041023 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000041023
Domain Number 1 Region: 6-416
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 4e-167
Family Phosphoglycerate kinase 0.00000000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000041023   Gene: ENSCJAG00000022394   Transcript: ENSCJAT00000043379
Sequence length 417
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:51003520:51005151:-1 gene:ENSCJAG00000022394 transcript:ENSCJAT00000043379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSKKLTLDKLDVRGKRVIMRVDFNVPMKKNQITNNQRIKASIPSIKHCLDNGAKAVVL
MSHLGRPDGVPMPDKYSLAPVAAELKSLLGKDVLFLKDCVGTEVEKACANPAPGSVILLE
NLRFHVEEEGKGQDPSGKKIKAEPDKIEAFRTSLSKLGDIYVNDAFGTAHRAHSSMVGVN
LPQKASGFLMKKELDYFAKALENPVRPFLAILGGAKVADKIQLIKNMLDKVNVMIIGGGM
AYTFLKVLNNMDIGASLFDDEGAKIVKDIMTKAQKNGVKITFPVDFVTADKFDENAQVGQ
ATVASGIPPGWMGLDCGPESNKNHAQVVAQAKLIVWNGPLGVFEWDAFAKGTKALMDEIV
KATSKGCITIIGGGDTATCCAKWSTEDKVSHVSTGGGASLELLEGKILPGVEALSNM
Download sequence
Identical sequences F7FGX4
ENSCJAP00000041023 ENSCJAP00000041023 XP_002746679.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]