SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000041229 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000041229
Domain Number 1 Region: 30-118
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.22e-34
Family Ribosomal L11/L12e N-terminal domain 0.00000649
Further Details:      
 
Domain Number 2 Region: 107-180
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 2.09e-18
Family Ribosomal protein L11, C-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000041229   Gene: ENSCJAG00000022630   Transcript: ENSCJAT00000043615
Sequence length 197
Comment pep:novel chromosome:C_jacchus3.2.1:5:121343802:121344711:-1 gene:ENSCJAG00000022630 transcript:ENSCJAT00000043615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNCNQLSARRRPRCNFLPSSRIWVHPTPATSTMPPKFDPNEIKVVYLRCTGGEVGATSAL
APKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEP
PRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHP
HDIIDDINSGAVECPAS
Download sequence
Identical sequences F7HAW7
ENSCJAP00000041229 ENSCJAP00000041229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]