SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000041299 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000041299
Domain Number 1 Region: 49-233
Classification Level Classification E-value
Superfamily Ribosomal protein S7 5.89e-47
Family Ribosomal protein S7 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000041299   Gene: ENSCJAG00000022706   Transcript: ENSCJAT00000043691
Sequence length 242
Comment pep:novel chromosome:C_jacchus3.2.1:16:25551218:25552187:1 gene:ENSCJAG00000022706 transcript:ENSCJAT00000043691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPAVKVSRGWSGLAPIMRQAVLQHPGLTQVRWSRYSAEFKDPLIDKEHYRKPVENLTE
EEKYDRELKKTQLIKAAPAAKTSSVFEDPVVSKFTNMMMKGGNKILARSLMTQTLEAVKR
KQFEKYHAASAEEQATIERNPYIIFHQALRNCEPMIGLVPILRGGRVYQVPTSLPDRRRH
FLVMKWMITECRENKHRRMLMPEKLSHELLEAFHNQGPVIKRKHDMHKMAEANHALAHYH
WW
Download sequence
Identical sequences F7H5P6
ENSCJAP00000041299 ENSCJAP00000041299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]