SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000041552 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000041552
Domain Number 1 Region: 66-142
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.84e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000041552   Gene: ENSCJAG00000023006   Transcript: ENSCJAT00000043991
Sequence length 160
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:155376290:155400114:1 gene:ENSCJAG00000023006 transcript:ENSCJAT00000043991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQS
FEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQV
LQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH
Download sequence
Identical sequences A0A024R4D4 A0A096NXQ0 A0A0D9SBT2 A0A1A6GFH2 A0A1U7SZY3 A0A1U8CDQ9 A0A2F0AUZ7 A0A2J8R5Q3 A0A2K5E169 A0A2K5L1V4 A0A2K5PL54 A0A2K5UIL7 A0A2K5XL67 A0A2K6B6S3 A0A2K6KNS9 A0A2K6N8K1 A0A2K6S0R2 A4IFM6 A5D6P6 E2RQT1 F2Z5R9 F6V9S4 F7FTJ2 G1QCG6 G1RKM7 H2RDU6 I3M4K6 L5KSL9 M3Z6T8 P97831 Q8WVJ9
ENSMPUP00000019301 ENSPANP00000017851 ENSSTOP00000004144 ENSCAFP00000018365 ENSRNOP00000027597 ENSSTOP00000004144 ENSNLEP00000013784 ENSSSCP00000017317 ENSBTAP00000028589 NP_001077217.1.59421 NP_001077217.1.76553 NP_001180741.1.72884 NP_001258822.1.87134 NP_001258822.1.92137 NP_031881.1.92730 NP_067723.1.100692 NP_067723.1.4139 NP_476527.1.87134 NP_476527.1.92137 XP_002750013.1.60252 XP_002813096.1.23681 XP_003133824.1.46622 XP_003277535.1.23891 XP_003309597.1.37143 XP_003936808.1.74449 XP_004001809.1.66739 XP_004092109.1.23891 XP_004262587.1.21590 XP_004323965.1.83887 XP_004427791.1.5094 XP_004455664.1.11602 XP_004667892.1.11716 XP_004743787.1.14098 XP_005361737.1.66349 XP_005574858.1.63531 XP_006066834.1.26621 XP_006083049.1.53796 XP_006909966.1.64745 XP_006995518.1.50099 XP_007184894.1.59432 XP_007470002.1.90284 XP_007965046.1.81039 XP_007965048.1.81039 XP_007965049.1.81039 XP_008051085.1.4292 XP_008051086.1.4292 XP_008136676.1.99482 XP_008526059.1.77740 XP_008526060.1.77740 XP_010357614.1.97406 XP_010359106.1.97406 XP_010847827.1.44457 XP_011726174.1.29376 XP_011726175.1.29376 XP_011835707.1.47321 XP_011835708.1.47321 XP_011835710.1.47321 XP_011898197.1.92194 XP_011898211.1.92194 XP_011989863.1.54773 XP_012328890.1.9421 XP_012977567.1.91757 XP_014322434.1.53796 XP_014698326.1.49734 XP_014966732.1.72884 XP_015443326.1.64745 XP_016806332.1.37143 XP_017393315.1.71028 XP_017731055.1.44346 XP_017895636.1.57651 XP_019483714.1.44202 XP_019483724.1.44202 XP_019567216.1.88060 XP_019567217.1.88060 XP_019779212.1.83887 XP_019813583.1.53367 XP_020043151.1.5219 XP_020736290.1.74333 XP_021054041.1.100879 XP_021502577.1.76796 XP_021575316.1.77405 XP_543311.1.84170 ENSMLUP00000021399 ENSP00000405176 ENSP00000482581 ENSMMUP00000014631 ENSMMUP00000028847 ENSP00000405176 ENSPTRP00000059365 ENSMPUP00000019301 ENSMUSP00000007949 ENSMUSP00000139531 ENSSSCP00000017317 ENSRNOP00000027597 ENSCJAP00000041552 GO.33806 HR6464 10090.ENSMUSP00000007949 10116.ENSRNOP00000027597 9544.ENSMMUP00000014631 9598.ENSPTRP00000059365 9606.ENSP00000405176 9615.ENSCAFP00000018365 9823.ENSSSCP00000017317 9913.ENSBTAP00000028589 gi|17981708|ref|NP_476527.1| ENSCJAP00000041552 ENSPTRP00000059365 ENSMLUP00000021399 ENSMMUP00000014631 ENSBTAP00000028589 ENSMUSP00000007949 ENSMUSP00000007949 ENSCAFP00000018365 ENSNLEP00000013784 ENSP00000405176 ENSDNOP00000022175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]