SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000041782 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000041782
Domain Number - Region: 52-98
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.00875
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000041782   Gene: ENSCJAG00000023270   Transcript: ENSCJAT00000044255
Sequence length 136
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:175017417:175017827:-1 gene:ENSCJAG00000023270 transcript:ENSCJAT00000044255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRPYPLAYLLLLQLGTYFPLLDRREPTDDMDGIGAGGSWANLAKGPQPHFVWGSSQWLR
VSWPQALLIMAKGLQMSGREHASHRFHFRRQDQGSEATSFLPAEGEKASDPLGNLAEELN
GYSRKKGGFSFRFGRR
Download sequence
Identical sequences F7FED7
XP_002743449.1.60252 ENSCJAP00000041782 ENSCJAP00000041782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]