SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000041842 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000041842
Domain Number 1 Region: 5-358
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 5.89e-51
Family Extradiol dioxygenases 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000041842   Gene: ENSCJAG00000023336   Transcript: ENSCJAT00000044321
Sequence length 371
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:80147731:80149532:1 gene:ENSCJAG00000023336 transcript:ENSCJAT00000044321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPALRLCHITFHVPAGQPLARDLQRLFSFQPLALREADGWRQQALRSGDAVFLVNEGA
GPGEPLYGLDPRHAVPSATNLCFDVADASAAARELAALGCSVPVPPVRVRDAQGAATYAV
VNSPAGNLSLTLLERAGYRGPFLPGFRPVLSASGPGWVSHVDHLTLACTPGSSPTLLRWF
HDCLGFCHLPLSPGEDPELGLEIAAGFGLGGLRLTALQAQAGSVVPTLVLAEPLPRATAG
QDQVEQFLARHKGPGLQHVGLYTPNILEATEGVATAGGQFLTPPGTYYQQPGKERQIRAA
GHQPHLLARQGILLDGDKGKFLLQVFTKSLFTEDTFFLELIQRQGATGFGQGNIRALWQS
VQEQAAWSQEA
Download sequence
Identical sequences F7DDE2
ENSCJAP00000041842 ENSCJAP00000041842 XP_002750796.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]