SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000042037 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000042037
Domain Number 1 Region: 136-317
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.88e-49
Family DNA repair glycosylase, 2 C-terminal domains 0.0000000245
Further Details:      
 
Domain Number 2 Region: 13-135
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 6.75e-38
Family DNA repair glycosylase, N-terminal domain 0.000000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000042037   Gene: ENSCJAG00000016101   Transcript: ENSCJAT00000055412
Sequence length 354
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:61661228:61680056:1 gene:ENSCJAG00000016101 transcript:ENSCJAT00000055412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARGILPRRLGHRTLASAPAMWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLA
DQVWTLTQTEEQLHCTVYRGDQSRAGRPTPDELEAVCKYFQLDVTLAQLYHHWGSVDSHF
QEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPQLIQLDDVTYHG
FPSLQALAGPDVEAHLRKLGLGYRARYVSASARAILEEQGGLAWLQQLREASYEEAHKAL
CTLPGVGTKVADCICLMALDKPQAVPVDVHMWQIAQRDYSWHPTMSQAKGPSPQTNKELG
NFFRSLWGPYAGWAQAVSIPRFPILRDPHRTSPPALTQWTTTTTPGGPPSWRCI
Download sequence
Identical sequences F6RT87
ENSCJAP00000042037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]