SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000042044 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000042044
Domain Number 1 Region: 44-280
Classification Level Classification E-value
Superfamily PLP-binding barrel 8.14e-63
Family Alanine racemase-like, N-terminal domain 0.000000118
Further Details:      
 
Domain Number 2 Region: 248-416
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.93e-34
Family Eukaryotic ODC-like 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000042044   Gene: ENSCJAG00000016087   Transcript: ENSCJAT00000057716
Sequence length 448
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:91662640:91700992:1 gene:ENSCJAG00000016087 transcript:ENSCJAT00000057716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKKAFFVGDLGKIVKKHSQWQNVVA
QIKPFYTVKCNSAPAVLEILAALGTGFACSSKNEMALVQELGVSPENIIYISPCKQVSQI
KYAAKVGVNIMTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHL
LECAKELDVQIIGVKFHVSSACKESQVYVHALSDARCVFDMAGEIGFTMNMLDIGGGFTG
TEFQLEEVNHVISPLLDIYFPEGSGVKIISEPGSYYVSSAFTLAVNIIAKKVVENDKFSS
GVEKTGSDEPAFMYYVNDGVYGSFASKLSEDLNAIPEVHKKYKEDEPLFTSSLWGPSCDE
LDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSDWYEMQDAGI
TSDAMMKNFFFVPSCIQLTQEDSFSTEA
Download sequence
Identical sequences F6RSV2
NP_001278385.1.60252 NP_001278386.1.60252 ENSCJAP00000029630 ENSCJAP00000029630 ENSCJAP00000042044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]