SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000042235 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000042235
Domain Number 1 Region: 203-432
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.85e-55
Family Voltage-gated potassium channels 0.00075
Further Details:      
 
Domain Number 2 Region: 40-158
Classification Level Classification E-value
Superfamily POZ domain 2.38e-28
Family Tetramerization domain of potassium channels 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000042235   Gene: ENSCJAG00000006183   Transcript: ENSCJAT00000058899
Sequence length 500
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:84582859:84590572:1 gene:ENSCJAG00000006183 transcript:ENSCJAT00000058899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSGRALLDSPLDSGSLTSLDSSVFCSEGEGEPLALGDCFTVNVGGSRFVLSQQALSCF
PHTRLGKLAVVVASYRRPGALAAVPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYYRTG
RLHVMEQLCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTEDQESQHES
EQDFSQGPCPTVRQKLWNILEKPGSSTAARIFGVISIIFVVVSIINMALMSAELSWLDLQ
LLEILEYVCISWFTGEFVLRFLCVRDRCHFLRKVPNIIDLLAILPFYITLLVESLSGSQT
TQELENVGRIVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGISIF
STVEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGILVL
ALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDVYARSIMEML
RLKGRERASTRSSGGDDFWF
Download sequence
Identical sequences F7ARX6
ENSCJAP00000042235 XP_002759331.1.60252 ENSCJAP00000042235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]