SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000042654 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000042654
Domain Number - Region: 14-106
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000714
Family Voltage-gated potassium channels 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000042654   Gene: ENSCJAG00000017791   Transcript: ENSCJAT00000054982
Sequence length 111
Comment pep:novel chromosome:C_jacchus3.2.1:5:154120030:154132398:-1 gene:ENSCJAG00000017791 transcript:ENSCJAT00000054982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKIKKIAHSIVSSFAFGIFGVCLLLLNVGLIFADLIFAEKKIYMPLEYRCISPSIAIFFL
MDILLRVFVDGWTPVVRHLRLIILTRIVHLVHQKRQLEKLIRRLVSENKRR
Download sequence
Identical sequences F6ZP67
ENSCJAP00000042654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]