SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000042677 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000042677
Domain Number 1 Region: 272-529
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.23e-74
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 148-255
Classification Level Classification E-value
Superfamily Kringle-like 5.8e-32
Family Kringle modules 0.00034
Further Details:      
 
Domain Number 3 Region: 45-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000222
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 4 Region: 87-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000132
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000042677   Gene: ENSCJAG00000019000   Transcript: ENSCJAT00000053053
Sequence length 534
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:101213306:101253184:1 gene:ENSCJAG00000019000 transcript:ENSCJAT00000053053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLFDALDADWTPDLYDESYEYSDQEETTSSTLAQPENPDWYYTEDQVDPCEPNPCEHGG
DCLVHGSTFTCSCLDPFSGTKCQKVQNRCKDNPCGRGQCLITQSPPYYRCACKHPYTGPN
CSQVVPVCRPNPCQNGGTCSRHKRRSKFTCACPDQFKGRFCEIGSDDCYVGDGYSYRGKI
NRTVNQHTCLYWNSHLLLQENYNMFMEDAEAHGIGEHNFCRNPDADEKPWCFIKVSSDKV
KWEYCNVTACSAQDIAYPEESPTEPLSKLPGLDSCGKTEITERKIKRIYGGFKSAAGKHP
WQASLQTSVPLTISMPQGHFCGGALIHPCWVLTAAHCTDIKARQLKVVLGDQDLKKAEFH
EQRFGVEKIFKYSHYNERDEIPHNDIGKVRLKPVNGHCALESKYVKTVCLPDRSFPSGTE
CHISGWGVTETGEGSRQLLDAKVKLISNTLCNSRQLYDHIIDDSMICAGNLQKPGQDTCQ
GDSGGPLTCEKDGTYYVYGIVSWGLECGKRPGVYTQVTKFLNWIKDTIQSQSDF
Download sequence
Identical sequences F6Z636
ENSCJAP00000042677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]