SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000042692 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000042692
Domain Number 1 Region: 123-190
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000236
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.03
Further Details:      
 
Domain Number 2 Region: 268-352
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000868
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00062
Further Details:      
 
Domain Number 3 Region: 32-93
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000785
Family HLH, helix-loop-helix DNA-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000042692   Gene: ENSCJAG00000007974   Transcript: ENSCJAT00000063343
Sequence length 354
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:22411744:22674117:-1 gene:ENSCJAG00000007974 transcript:ENSCJAT00000063343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGMGENTSDPSRAETRKRKECPDQLGPSPKRNTEKRNREQENKYIEELAELIFANFNDI
DNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMML
EALDGFFFVVNLEGNVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSI
VNGGSWSGEPPRRNSHTFNCRMLVKPLPDSEEEGHDNQEAHQKYETMQCFAVSQPKSIKE
EGEDLQSCLICVARRVPMKERPVLPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLV
RRCIQKFHAQHEGESVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSK
Download sequence
Identical sequences F6Z5D9
ENSCJAP00000042692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]