SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000042722 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000042722
Domain Number 1 Region: 81-151
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000112
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.06
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000042722
Domain Number - Region: 10-49
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000843
Family HLH, helix-loop-helix DNA-binding domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000042722   Gene: ENSCJAG00000001482   Transcript: ENSCJAT00000052613
Sequence length 232
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:122147206:122152088:1 gene:ENSCJAG00000001482 transcript:ENSCJAT00000052613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFSGGT
PLAGPTGLLSAQELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIY
DIIDPADHLTVRQQLTLPSALDTDRLFRCRFNTSKSLRRQSAGNKLVLIRGRFHAHPPGA
YWAGNPVFTAFCAPLEPRPRPGPGPGPASLFLAMFQSRHAKDLALLDISESG
Download sequence
Identical sequences F6WSP4
ENSCJAP00000042722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]