SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000042783 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000042783
Domain Number 1 Region: 1-240
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.31e-77
Family Carbonic anhydrase 0.00000000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000042783   Gene: ENSCJAG00000000373   Transcript: ENSCJAT00000063140
Sequence length 240
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:37349112:37357233:-1 gene:ENSCJAG00000000373 transcript:ENSCJAT00000063140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPEQWGKLYPIANGNNQFPIDIKTSEAKHDTFLKPLSYKPATAKEIINVGHSFHVNFEDN
DNQLVVKGGPLSNSYRLHQLHFHRYGSEHTVDGFKYSGELHIVHWNPEKYSSLAEAISEA
DALAVIGVLLKVGEANPKLQKVLDALHAIKTKGKQAPFTNFDPSTLPSSLNFWTYSGSLT
HPPLYESVTWIICKESISVSSEQLAQFRALLSNVEGDNPVPIQHNYPTQPVKGRTVRASF
Download sequence
Identical sequences F6UGT2
ENSCJAP00000042783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]