SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000042876 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000042876
Domain Number 1 Region: 418-526
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000565
Family YkuI C-terminal domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000042876   Gene: ENSCJAG00000016656   Transcript: ENSCJAT00000061470
Sequence length 978
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:100083984:100218173:1 gene:ENSCJAG00000016656 transcript:ENSCJAT00000061470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTFVSSVKSSDSPTQHAVGFQKAFQLIRSTNNNTKFQANTDMVIIYLSAGITSKDSSEE
DKKETLRVINEENSFLNNSVMILTYALMNDGVTGLKELAFLRDLAEQNSGKYGVPDRTTL
PVIKGSMMVLNQLSNLETTVGRFYTNLPNRMIDEAVFSLPFSDEMGDGLIMTVSKPCYFG
NLLLGIVGVDVNLAYILEDVTYYQDSLASYTFLIDDKGYTLMHPSLTRPYLLSEAPLHTD
IIHYENIPKFELVRQNILSLPLGSQIIAVPVNSSLSWHINKLRETGKEAYNVSYAWKMVQ
DTSFILCIVVIQPEVPVKQLKNLNTVPSSKLLYHRLDLLGQPSACLHFKQLATLESPTVM
LSAGSFSSPYEHLSQPETKRMVEHYTAYLSDNTRLIANPGLKFSVRNEVMATSHVTDEWM
TQMEMSSLNTYIVRRYIATPNGVLRIYPGSLMDKAFDPTRRQWYLHAVANPGLISLTGPY
LDVGGAGYVVTISHTIHSSSTQLSSGHTVAVMGIDFTLRYFYKVLMDLLPVCNQDGGNKI
RCFIMEDRGYLVAHPTLIDPKGHAPVEQQHITHKEPLVANDILNHPNFVKKNLCNSFSDR
TVQRFYKFNTSLVGDLTNLVHGSHCSKYRLARIPGTNAFVGIVNETCDSLAFCACSMVDR
LCLNCHRMEQNECECPCECPLEVNECTGNLTNAENRNPSCEVHQEPVTYTAIDPGLQDAL
HQCVNSRCSQRLESGDCFGVLDCEWCMVDSDGKTHLDKSYCAPQKECFGGIVGAKSPYVD
DMGAIGDEVITLNMIKSAPVGPVAGGIMGCIMVLVLAVYAYRHQIHRRSHQHMSPLAAQE
MSVRMSNLENDRDERDDDSHEDRGIISNTRFIAAVIERHAHSPERRRRYWGRSGTESDHG
YSTMSPQEDSENPPCNNDPLSAGVDVGNHDEDLDLDTPPQTAALLSHKFHHYRSHHPTLH
HSHHLQAAVTVHTVDAEC
Download sequence
Identical sequences F6Z4M9
ENSCJAP00000042876 ENSCJAP00000043910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]