SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043048 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043048
Domain Number 1 Region: 285-352
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.57e-16
Family HLH, helix-loop-helix DNA-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043048   Gene: ENSCJAG00000013260   Transcript: ENSCJAT00000058091
Sequence length 504
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:46170566:46269428:1 gene:ENSCJAG00000013260 transcript:ENSCJAT00000058091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALRVQMFMPCSFESLYLSSAEHPGASKPPISSSSMTSRILLRQQLMREQMQEQERREQ
QQKLQAAQFMQQRVPVSQTPAINVSVPTTLPSATQVPMEVLKVQTHLENPTKYHIQQAQR
QQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEGF
YKFEEQNRAESECPGMNTHSRASCMQMDDVIDDIISLESSYNEEILGLMDPALQMANTLP
VSGNLIDLYGNQGLPPPGLTISNSCPANLPNIKRELTESEARALAKERQKKDNHNLIERR
RRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQREQQRAKELENRQKKLE
HANRHLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADL
TCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSS
VSPGASKTSSRRSSMSMEETEHAC
Download sequence
Identical sequences A0A2I3MYK3 A0A2K5ZRR0 F7HWE8 I2CV82
NP_001253786.1.72884 XP_002758591.1.60252 XP_005547651.1.63531 XP_011826455.1.47321 XP_011915222.1.92194 ENSCJAP00000043048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]