SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043051 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043051
Domain Number 1 Region: 603-707
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 1.46e-28
Family Lipoxigenase N-terminal domain 0.023
Further Details:      
 
Domain Number 2 Region: 1321-1374,1412-1534
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000863
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043051   Gene: ENSCJAG00000015072   Transcript: ENSCJAT00000062674
Sequence length 1589
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:20:26294225:26383965:1 gene:ENSCJAG00000015072 transcript:ENSCJAT00000062674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLDRDARYERNGNNSHLPWRPKKTKREVEIPRNRMPPGAAHLSTTCHHPPHAHLSKMLCH
PISPFSSVLPKITTQVTPVTSEPSSQPLPARTEPTSPVSVTHAGQSQTEMASSPEEDAHP
HSFTSHPPASLQNASGQVIDETVGNFSRAIHGLQAHNKLQEACEVLQTLTALTPRFSKPA
QVHLINSLIYLSEQLLRIPFQNNSSLGFKVPATLCLFHSFNNVIKAGEGSWQGSKHDPEQ
VEDMLEMSLVALGNIGEALLEQKQPPESSVTLTSSIASLLLSRLTGEEGTGRVSLCFSLS
EAIEKLTSFFTSVLMPLYSSLVDRVTGLAFNPFKDLDNRNVVGSIGSVLLSANHKVLQVH
DLMEDIEIMLWRNVSLETHPTSVNMSTDQFTITVNITSLEKSLIVSIDSDSPLLMTLYLG
FQYQPNCTHFHLNITLPKDNVWQKDEEYTWVLTPERLQHGIGTYYVTAVLSESQEGAQQM
PSLVSVITAVTQCYYWDSHNRTWSSNGCQVGPQSTILRTQCLCNHLTFFASDFLVVPRTV
NVEDTIILFLRVTSNPVGVSLLASLLGFYVITVVWAWRKDQADMQKVKVTVLADNDPSAQ
FHYLIQVYTGYRRRAATTAKVVITLYGSEGRSEPHHLCDPQKRVFERGGLDVFLLTTHSS
LGELHSLRLWHDNSGLSPSWYVTQVIVCDMAVKRKWHFLCNCWLAVDLGDCEIDRVFIPV
SKRELFSFRHLFSSMIVEKFTQEYLWLSVATRHPWNLFTRVQRLSCCLTLLLCNMVISIM
FWKINGTTGKRDEQMGTFAVAWSELLISIHTAVILFPVNLVIGRLFPLIQPQEIVPLFPP
VQVSCLLDASVEPLSVTMVVEELRETVRFLLRRHTYLLSECEQPSWNSCNITKLVELLSS
LLSSHLEGQGGHQQAERHRACVVPENHHHFCCYLCRVLQRLKSHLGTLGLTQGHQTCDLL
AAASHLQKLQELLETHMLPTEQEPFREVTSFAILSSEEGKRPLSNGLSKWLSLFCWFLLG
LTSLASAFFTALYSLELNKDQATSWMISVILSVLQNVLISQPVKVVVFTFFHSVMMSRVP
RLHKEEEQQTRRILALLAKCSSSVPGSRDKNNPVYVAPTMNSPTKRPERTLEKKKLFKLT
GDILVQIFFLTLLMTTIYSAKNSNRFYLHRAIQRTFAHRFSEIKLLQDFYPWANHILLPN
LYGDYRGKNAVLELSHCKCGIQLIFQIPATKTHEKVEGQLAFIDGRTCGCLKGLFPEPHL
SRFSYICSPRPMGLISTDEFHKKLTRMRMDWCSSLFSGAFFTSVRLESFTSLQMSKKGFV
WSVISQVIYYLLICYYAFIQGCRLKRQKWRFFTRKRNILDTSIILISFIILGLDMKSISL
HKKNMARYHHDRDRFISFYEAVKVNSAATHLVGFLVLLATVQLWNLLRHSPRLWVISRTL
SRAWDEVLGFLLIILILLTGYAIAFNLLFGCNVSDYQTFFSSAVTIVGLLTGISHQEEVI
ALDPVLGTFLILTSVILMVLVVINLFVSAILMAFGKERKSLKRQVALIDMLLQKLSSLLG
IRQPQKTSSEQAATTSMGIDTEVLEDELP
Download sequence
Identical sequences F7HWD7
ENSCJAP00000043051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]