SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043294 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043294
Domain Number 1 Region: 298-555
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.44e-77
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 174-281
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-32
Family Kringle modules 0.00034
Further Details:      
 
Domain Number 3 Region: 71-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000248
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 4 Region: 113-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000014
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043294   Gene: ENSCJAG00000019000   Transcript: ENSCJAT00000062630
Sequence length 560
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:101213306:101253184:1 gene:ENSCJAG00000019000 transcript:ENSCJAT00000062630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFARMSDLHVLLLMALVGKTAFGFSLMSLFDALDPDWTPDLYDESYEYSDQEETTSSTLA
QPENPDWYYTEDQVDPCEPNPCEHGGDCLVHGSTFTCSCLDPFSGTKCQKVQNRCKDNPC
GRGQCLITQSPPYYRCACKHPYTGPNCSQVVPVCRPNPCQNGGTCSRHKRRSKFTCACPD
QFKGRFCEIGSDDCYVGDGYSYRGKINRTVNQHTCLYWNSHLLLQENYNMFMEDAEAHGI
GEHNFCRNPDADEKPWCFIKVSSDKVKWEYCNVTACSAQDIAYPEESPTEPLSKLPGLDS
CGKTEITERKIKRIYGGFKSAAGKHPWQASLQTSVPLTISMPQGHFCGGALIHPCWVLTA
AHCTDIKARQLKVVLGDQDLKKAEFHEQRFGVEKIFKYSHYNERDEIPHNDIALLKLKPV
NGHCALESKYVKTVCLPDRSFPSGTECHISGWGVTETGEGSRQLLDAKVKLISNTLCNSR
QLYDHIIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSWGLECGKRPGVY
TQVTKFLNWIKDTIQSQSDF
Download sequence
Identical sequences F7I810
ENSCJAP00000042677 XP_002756483.1.60252 ENSCJAP00000043294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]