SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043323 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043323
Domain Number 1 Region: 268-610
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.04e-49
Family Quinoprotein alcohol dehydrogenase-like 0.0091
Further Details:      
 
Domain Number 2 Region: 8-56
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 0.000000102
Family Acetyl-CoA synthetase-like 0.0062
Further Details:      
 
Domain Number 3 Region: 68-121
Classification Level Classification E-value
Superfamily ACP-like 0.00000615
Family Peptidyl carrier domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043323   Gene: ENSCJAG00000018076   Transcript: ENSCJAT00000062386
Sequence length 612
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:137158896:137202019:1 gene:ENSCJAG00000018076 transcript:ENSCJAT00000062386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSKDALVKDYIFKELQKHLPSHAIPDELVLIDTLPFTSHGKIDVSELNKIYLNYINLKS
ENKLSGKEDLWEKLQYLWKSTLNLPDLLKVPDESRFLNSGGDSLKSMRLLSEIEKLVGTL
VPGLLEMILSSSILEIYNHILQTVFPDEDVTFRKSCATKRKLSNINQEEASGTSLHQKAI
MTLSCHNKINAFVALSRGSQILSLNTTRFLPKLGHCSSAYPSDSVSQTNTQNLKGLNSPV
LIGKSKDPSCVAKVPEEGKPAIGTQKMELHMRWRSDTGKCVDASPLVVIPSFDESSTTVY
IGSHSHKMKAVDFYSGKVKWEQSLGDRIESSACVSKCGNFIVVGCYNGLVYVLKSNSGEK
YWMFTTEDTVKSSPTMDPTTGLIYIGSHDQHAYALDIYRKNCVWKSKCGGTVFSSPCLNL
IPHHLYCATLGGLLLAVNPATGNVIWKHSCGKPLFSSPRCCSQYICIGCVDGNLLCFTHF
GEQVWQFSTSGPIFSSPCTSPSEQKIFFGSHDCFIYCCNMKGHLQWKFETTSRVYATPFA
FHNYNSSNEMLLAAASTDGKLWILESQSGQLQSVYELPGEVFSSPVVLESMLIIGCRNNY
VYCLDLLGGNQK
Download sequence
Identical sequences F7HSQ7
ENSCJAP00000043323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]