SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043502 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043502
Domain Number 1 Region: 37-132
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-26
Family SH2 domain 0.0000017
Further Details:      
 
Domain Number 2 Region: 150-197
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000000379
Family SOCS box-like 0.0000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043502   Gene: ENSCJAG00000002964   Transcript: ENSCJAT00000062110
Sequence length 198
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:83546557:83553632:1 gene:ENSCJAG00000002964 transcript:ENSCJAT00000062110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPEAARLAKALRELGQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIVCVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWG
LPLPTRLKDYLEEYKFQV
Download sequence
Identical sequences F7ICH5
ENSCJAP00000005372 ENSCJAP00000043502 ENSCJAP00000005367 XP_002752901.1.60252 XP_009002617.1.60252 XP_017831768.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]